Protein Info for LRK54_RS10000 in Rhodanobacter denitrificans FW104-10B01

Annotation: type II secretion system protein GspM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 215 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details PF10741: T2SSM_b" amino acids 79 to 193 (115 residues), 78.6 bits, see alignment E=1.6e-26

Best Hits

KEGG orthology group: K02462, general secretion pathway protein M (inferred from 40% identity to pfs:PFLU4072)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (215 amino acids)

>LRK54_RS10000 type II secretion system protein GspM (Rhodanobacter denitrificans FW104-10B01)
MKTIAMNPRDSRIAAIILLLLALALAYVVLLRWWFVVPLRQVRAEMADLRDTHSRYAAAI
AEKPALQQRLAALGAGQAASSAFLAADDPNTAAGDLMQRVIDVVAANAGGGQCTVTQKMP
LPSPAPSAGEPYRKAAVSISLNCDMAPLAAVLQALEQGTPYLFVDDLSIYRNPVVAQQNN
AAALEVQFSLSGYVRPARTAPASSDRAPDDAGGVP