Protein Info for LRK54_RS09720 in Rhodanobacter denitrificans FW104-10B01

Annotation: pteridine-dependent deoxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 334 PF21168: FkbO_Hyg5-like_N" amino acids 69 to 191 (123 residues), 120.1 bits, see alignment E=2.9e-39

Best Hits

KEGG orthology group: None (inferred from 51% identity to psu:Psesu_2797)

MetaCyc: 51% identical to 3/4-hydroxybenzoate synthase (Xanthomonas campestris pv. campestris)
RXN-14940 [EC: 4.1.3.45]; Chorismate lyase. [EC: 4.1.3.45, 4.1.3.40]

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.3.40 or 4.1.3.45

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (334 amino acids)

>LRK54_RS09720 pteridine-dependent deoxygenase (Rhodanobacter denitrificans FW104-10B01)
MMQGCENPQMDPLPRRAPQVCYRTGEAAALLAEPGTLALFGFGAGTPASADPRYLQVALE
PFDAGAPLELWRVDAPVSCGSDGALHWSAGGGWLFVALELDEREHGGPTATARLAYERLH
RFVATRAAQHVLRVWNYLGAINHGDGDAERYKHFCDGRAAGMGDFFAEGFPAATAIGHHG
DEHRLQVYLLAGDQAGLRVENPRQVSAWRYPRQYGRTPPSFARAMALPAQDVLAISGTAA
VVGHASAHQDDLDAQLEETLLNLETLLASAGMAAGFDPRSPLKVYVRHAADAARARDFLQ
HRLPGVPLLLLHGDICRRELLVEIDGWRYAWSGE