Protein Info for LRK54_RS09455 in Rhodanobacter denitrificans FW104-10B01

Annotation: RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 193 PF07638: Sigma70_ECF" amino acids 24 to 180 (157 residues), 32.9 bits, see alignment E=1.2e-11 PF04542: Sigma70_r2" amino acids 31 to 95 (65 residues), 29 bits, see alignment E=1.5e-10 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 40 to 180 (141 residues), 68.3 bits, see alignment E=3.1e-23 PF08281: Sigma70_r4_2" amino acids 129 to 178 (50 residues), 67.4 bits, see alignment E=1.4e-22 PF04545: Sigma70_r4" amino acids 133 to 181 (49 residues), 36.1 bits, see alignment E=7.6e-13

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 35% identity to pfs:PFLU1407)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (193 amino acids)

>LRK54_RS09455 RNA polymerase sigma factor (Rhodanobacter denitrificans FW104-10B01)
MLTLRHGSAQADRRTSDATSAADDEPFAGLLEDLIPGLRRHLQHQLGSADAADDAVQETC
LRMLRYRGIGDAGEVRALLFHVAASVVADRWRRAKVQHSEDHCQLDGQELVSSEPQPDRL
LAGRQDLGLIKQAIRTLPPRCREVFVLHRFEGLSYRDIARRFGTSERTVENQIAHALAVC
RCAIGEHRGRTFK