Protein Info for LRK54_RS08570 in Rhodanobacter denitrificans FW104-10B01

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 119 to 139 (21 residues), see Phobius details amino acids 159 to 177 (19 residues), see Phobius details PF00288: GHMP_kinases_N" amino acids 119 to 173 (55 residues), 31.3 bits, see alignment 1.1e-11

Best Hits

Predicted SEED Role

"Phosphomevalonate kinase (EC 2.7.4.2)" in subsystem Archaeal lipids or Isoprenoid Biosynthesis (EC 2.7.4.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.4.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>LRK54_RS08570 hypothetical protein (Rhodanobacter denitrificans FW104-10B01)
MRVLATAPGKLVIAGEYAVLEGAPALVLAIDRQARVTLEDTDGSDYEITAPGLGIDAAHG
RLDAAGRIAWPALDAAASAPLRLVGAILETLGAEDRPPPFRASLDTRAFHAGSDSRRKLG
LGSSAALTVALASAIGTLGRRGVPSLDTLLAAHRRAQDGYGSGLDVAASLTGGLLLYRLH
DGQPRIAPATWPQGLAWCCVWTGRPASTGLFLQRLAAWRAQAPARHAAAMRELGDCATAA
AGATSAAALLEAVAACAQALERLGAASGLDIFSPEHRALAALAARLGVAYKTCGAGGGDI
GITLATDAARLQAFRRAASAAGFPVLDLHPAAAASVQAH