Protein Info for LRK54_RS07075 in Rhodanobacter denitrificans FW104-10B01

Annotation: magnesium-translocating P-type ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 884 transmembrane" amino acids 80 to 99 (20 residues), see Phobius details amino acids 105 to 123 (19 residues), see Phobius details amino acids 276 to 296 (21 residues), see Phobius details amino acids 305 to 330 (26 residues), see Phobius details amino acids 691 to 708 (18 residues), see Phobius details amino acids 713 to 732 (20 residues), see Phobius details amino acids 753 to 775 (23 residues), see Phobius details amino acids 787 to 806 (20 residues), see Phobius details amino acids 817 to 839 (23 residues), see Phobius details amino acids 853 to 875 (23 residues), see Phobius details TIGR01524: magnesium-translocating P-type ATPase" amino acids 29 to 883 (855 residues), 1272.5 bits, see alignment E=0 PF00690: Cation_ATPase_N" amino acids 35 to 95 (61 residues), 57 bits, see alignment 3.5e-19 PF00122: E1-E2_ATPase" amino acids 142 to 339 (198 residues), 127.6 bits, see alignment E=1.2e-40 TIGR01494: HAD ATPase, P-type, family IC" amino acids 257 to 388 (132 residues), 67.2 bits, see alignment E=1e-22 amino acids 593 to 713 (121 residues), 107.2 bits, see alignment E=7.1e-35 PF00702: Hydrolase" amino acids 355 to 638 (284 residues), 56.4 bits, see alignment E=1.7e-18 PF13246: Cation_ATPase" amino acids 385 to 464 (80 residues), 37.2 bits, see alignment E=7.4e-13 PF00689: Cation_ATPase_C" amino acids 707 to 875 (169 residues), 67.5 bits, see alignment E=3.9e-22

Best Hits

Swiss-Prot: 55% identical to ATMA_ECO57: Magnesium-transporting ATPase, P-type 1 (mgtA) from Escherichia coli O157:H7

KEGG orthology group: K01531, Mg2+-importing ATPase [EC: 3.6.3.2] (inferred from 62% identity to azc:AZC_0192)

Predicted SEED Role

"Mg(2+) transport ATPase, P-type (EC 3.6.3.2)" (EC 3.6.3.2)

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.2

Use Curated BLAST to search for 3.6.3.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (884 amino acids)

>LRK54_RS07075 magnesium-translocating P-type ATPase (Rhodanobacter denitrificans FW104-10B01)
MIKQSIQGALPRAADRGASAPLHVAVAQEAFRANSELLASLETTPAGLDEEQIEARLHRD
GINEVSYEKPPHWSRQLLRAFKNPFIIVLLVLAVVQMFATPDDLSGPIIIAAMVGISVLL
SFTQEYRSSKAAEKLKAMVRNTATVTRRASDGHSERIEVPVGELVAGDIVHLAAGDMVPA
DLRLLHAKDLFISQAILTGESLPVEKAAPGAHGAAEADHANPLDLPTICYMGTNVVSGTA
TAVAVATGPRSYLGSLAHSIVGQRVQTSFDRGVNSVSWLLIRFMAVMVPVVFLINGFDKH
DWLQAFMFALSVAVGLTPEMLPLIVTANLAKGALAMSRRKVVVKRLNAIQNFGAMDVLCT
DKTGTLTLDKIVLERHLDLHGEESDEALEYGYLNSRFQTGLKNLMDKAVLAHRDLEPAAA
HYRIVDEIPFDFQRRRMSVVLGNGDGHDLIVCKGAVEEMLSICTWAKTGDQIVPMTDAQR
DEIKEMTRGLNEDGLRVLVVAVKQQPPAGRPYGVADESGLTAVGCLAFLDPPKDSAATAI
AALHHHGVQVKVITGDNEAVTRKICREVGLDVEHSAQGRQIEPLDDAALDELVKRTTVFA
KMSPLQKARVVKSLQRQGHTVGFLGDGINDAPALREADVGISVDTATDIAKESADIILLE
KNLMVLEEGVIEGRITFGNIIKYIKMTASSNFGNMFSVLVASAFLPFLPMLPLQILVLNL
LYDISQLSIPFDRMDDEYLRKPRKWDASDIGRFMVWIGPVSSIFDITTFLLLWHVFGANS
MAHQPFFQSGWFIESLLTQTLIVHMIRTRRIPFLQSIASAPVLALTTAVILIGLFVPFTG
LGAKIGMVALPPAFFGWVALTVLTYGVLTQLMKLVYIRRYGRWL