Protein Info for LRK54_RS06620 in Rhodanobacter denitrificans FW104-10B01

Annotation: 6-phosphofructokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 PF00365: PFK" amino acids 16 to 297 (282 residues), 172 bits, see alignment E=9.3e-55

Best Hits

Swiss-Prot: 77% identical to PFP_XANCB: Pyrophosphate--fructose 6-phosphate 1-phosphotransferase (pfp) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K00850, 6-phosphofructokinase [EC: 2.7.1.11] (inferred from 77% identity to sml:Smlt3887)

Predicted SEED Role

"6-phosphofructokinase (EC 2.7.1.11)" in subsystem D-Tagatose and Galactitol Utilization or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or N-Acetyl-Galactosamine and Galactosamine Utilization (EC 2.7.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>LRK54_RS06620 6-phosphofructokinase (Rhodanobacter denitrificans FW104-10B01)
MSPSRRSPAVTGNLLYAQSGGVTAVINATAAGVIEAARGKGVKVYAARNGILGALREELI
DTSKESATAIAALRHTPGGAFGSCRYKLKSLEENRAEYERLIEVFRAHDIRWFLYNGGND
SADTALKISQLGKALGYDIRCIGVPKTVDNDLAVTDCCPGFGSVAKYTAISTLEASLDVA
SMADTSTKVFILEVMGRHAGWIAAAAGLAGEGADAPPHIILFPENALDEAAFLAKVKATV
ERVGWCTVVASEGVRNAAGQFLAEAGTRDAFGHSQLGGVAPVLAALVKEKLGYKYHWALP
DYLQRSARHAASQVDAEQAYAVGKAAVDYALAGMNAVMPVIVRTSDAPYRWKIEPAPLAK
IANREKKMPKNFISRDGFGITAAARRYLAPLIRGEAPPPYGKDGLPRYVRLKNAAVAGRL
PPFTP