Protein Info for LRK54_RS05965 in Rhodanobacter denitrificans FW104-10B01

Annotation: biotin--[acetyl-CoA-carboxylase] ligase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 329 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details PF08279: HTH_11" amino acids 6 to 55 (50 residues), 43.5 bits, see alignment 2.4e-15 TIGR00121: biotin--[acetyl-CoA-carboxylase] ligase" amino acids 85 to 325 (241 residues), 134.9 bits, see alignment E=1.7e-43 PF03099: BPL_LplA_LipB" amino acids 97 to 215 (119 residues), 56 bits, see alignment E=4.3e-19

Best Hits

KEGG orthology group: K03524, BirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC: 6.3.4.15] (inferred from 46% identity to xca:xccb100_4124)

Predicted SEED Role

No annotation

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (329 amino acids)

>LRK54_RS05965 biotin--[acetyl-CoA-carboxylase] ligase (Rhodanobacter denitrificans FW104-10B01)
MQPAELLALLAEGESLSGAGLAARTGVTRAAIWKQVEALRARGVPIEARGTTGYRLPWPL
QMLDAKRIRAALPTPLARSLGALEVHWELDSTSSELQRRGNAAKDFSIVLAETQRAGRGR
RGRTWLSPPGLNLYLSCLKRFESGCAALSGLSLAVGVMVLRALEQLGIAGAGLKWPNDVL
AVGGDRAGGKLGGILVELSGEYQGPCAAIIGIGLNLRLTPALREQAGQPACDLATLAGGT
PPDRNRAAAALVQVLVEGLRQFEREGFAAFVDDYARHDLLRDQPLQLSGAPGVFDGVGAG
VDGRGALQVRMADGSMRRIDSADVTVRRA