Protein Info for LRK54_RS04705 in Rhodanobacter denitrificans FW104-10B01

Annotation: DMT family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 57 (20 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 96 to 116 (21 residues), see Phobius details amino acids 123 to 141 (19 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 176 to 195 (20 residues), see Phobius details amino acids 207 to 226 (20 residues), see Phobius details amino acids 237 to 256 (20 residues), see Phobius details amino acids 262 to 279 (18 residues), see Phobius details PF00892: EamA" amino acids 12 to 139 (128 residues), 50.4 bits, see alignment E=1.4e-17 amino acids 147 to 279 (133 residues), 64.4 bits, see alignment E=6.3e-22

Best Hits

KEGG orthology group: None (inferred from 56% identity to ica:Intca_1964)

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>LRK54_RS04705 DMT family transporter (Rhodanobacter denitrificans FW104-10B01)
MNARTTSIVATLGLLAMTAVWGSTFVLIKGVVGRMPVADFLAVRFVIAAAAMLALFARPV
WRLGRRQVLHGLVLGTIYGIGQLLQTWGLSLIAPSVSGFATGMYVVFTPILALLLLGQRM
AGMVWLAVGLSTVGLALLSLNGVSVDFGVWLTLASAALYALHIVLLGQWSRQGEAFGLSA
VQMVAIAAVCLLAIVPHAPVLPPDRSAWFAVLYMALIAGAGAMLMQTWAQSHLPATRAAI
VMTTEPVFAAAFAVLLGSDVLSWRMLLGGGLILAAMYLVELMPRRGALPAEAAHHEV