Protein Info for LRK54_RS04320 in Rhodanobacter denitrificans FW104-10B01

Annotation: uroporphyrinogen decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01208: URO-D
  • amino acids 6 to 349 (344 residues), 466.5 bits, E=2.5e-144
• TIGR01464: uroporphyrinogen decarboxylase
  • amino acids 10 to 347 (338 residues), 429.7 bits, E=3.6e-133

Best Hits

Swiss-Prot: 66% identical to DCUP_BURTA: Uroporphyrinogen decarboxylase (hemE) from Burkholderia thailandensis (strain ATCC 700388 / DSM 13276 / CIP 106301 / E264)

KEGG orthology group: K01599, uroporphyrinogen decarboxylase [EC: 4.1.1.37] (inferred from 66% identity to bte:BTH_I3304)

MetaCyc: 60% identical to uroporphyrinogen decarboxylase (Escherichia coli K-12 substr. MG1655)
Uroporphyrinogen decarboxylase. [EC: 4.1.1.37]

Predicted SEED Role

"Uroporphyrinogen III decarboxylase (EC 4.1.1.37)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 4.1.1.37)

MetaCyc Pathways

• superpathway of heme b biosynthesis from glutamate (10/10 steps found)
• superpathway of heme b biosynthesis from glycine (7/8 steps found)
• heme b biosynthesis I (aerobic) (4/4 steps found)
• heme b biosynthesis II (oxygen-independent) (3/4 steps found)
• heme b biosynthesis V (aerobic) (3/4 steps found)
• superpathway of heme b biosynthesis from uroporphyrinogen-III (4/6 steps found)
• heme b biosynthesis IV (Gram-positive bacteria) (2/5 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis I (aerobic, light-dependent) (3/9 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis III (aerobic, light independent) (3/9 steps found)
• 3,8-divinyl-chlorophyllide a biosynthesis II (anaerobic) (2/9 steps found)
• superpathway of bacteriochlorophyll a biosynthesis (5/26 steps found)

KEGG Metabolic Maps

• Porphyrin and chlorophyll metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.1.37

Protein Sequence (356 amino acids)

>LRK54_RS04320 uroporphyrinogen decarboxylase (Rhodanobacter denitrificans FW104-10B01)
MTDVLKNDRFLRALRREPTDTTPIWVMRQAGRYLPEYRATRERAGSFLGLAQHPEYACEV
TLQPLERFELDAAILFSDILTIPDAMGLGLSFAHGEGPQFARPLRTAADIDKLAVPDMDG
ELRYVMDAVRLIRRELHGRAPLIGFSGSPWTLACYMVEGHGSRDFATLKAMCWNEPKLAH
QLLDTLARAVAAYLIAQAEAGAQALMIFDTWGGLLGPAPFREFSLRSMAQIVAALKADPT
ARELPVILFSKGAGMHLAEMADSGCAALGVDWTIDLADARRAVAGKVALQGNLDPAVMRA
SPEVIRREARAVLDSYGNHPGHVFNLGHGITPEVDPEHLKVLVDEVHAYGRALRGA