Protein Info for LRK54_RS03900 in Rhodanobacter denitrificans FW104-10B01

Annotation: class I SAM-dependent methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 285 PF13489: Methyltransf_23" amino acids 73 to 214 (142 residues), 94.7 bits, see alignment E=1.5e-30 PF07021: MetW" amino acids 77 to 156 (80 residues), 29.5 bits, see alignment E=1.8e-10 PF13847: Methyltransf_31" amino acids 78 to 177 (100 residues), 45.5 bits, see alignment E=2.1e-15 PF08242: Methyltransf_12" amino acids 81 to 167 (87 residues), 63.6 bits, see alignment E=7.2e-21 PF08241: Methyltransf_11" amino acids 81 to 170 (90 residues), 64.2 bits, see alignment E=4.4e-21 PF13649: Methyltransf_25" amino acids 81 to 166 (86 residues), 54.2 bits, see alignment E=5.7e-18

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (285 amino acids)

>LRK54_RS03900 class I SAM-dependent methyltransferase (Rhodanobacter denitrificans FW104-10B01)
MAYANYSTHAPALKPKRTGILGNLRDCIRNGYLNRRYGYKLQPAPAWGYWAMYLLPAPIR
WEQDQHARHLPPPHSPCERLLDIGCGNGEFLINARAAGWAVLGLEPDKQAASIGRQHGLE
VHCTTYDCADLPPESFDVITSNQVIEHVHDPHAFVSRIHHWLKPGGTVWIGTPNLDSLMH
AHFGINYGNLHPPQHLLMFSPSTLRRLFEYHGFASIEFHKRGFHDYSQSLGSAALMRGEA
GPSVYLGVKHAPLRDKIRGMYFELAAWRDFRACSDLVMLAKKASS