Protein Info for LRK54_RS02880 in Rhodanobacter denitrificans FW104-10B01

Annotation: M13 family peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 707 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF05649: Peptidase_M13_N" amino acids 67 to 445 (379 residues), 396 bits, see alignment E=2.5e-122 PF01431: Peptidase_M13" amino acids 497 to 704 (208 residues), 242.3 bits, see alignment E=3.8e-76

Best Hits

KEGG orthology group: K07386, putative endopeptidase [EC: 3.4.24.-] (inferred from 61% identity to xcb:XC_1543)

Predicted SEED Role

"Metallopeptidase"

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (707 amino acids)

>LRK54_RS02880 M13 family peptidase (Rhodanobacter denitrificans FW104-10B01)
MTKQFLKPLALALAVSLALTACGKHEAASNAPAPASTAPAAAGTTAAADLGKSIFDVSEL
GDGAQACQDFNGFVNAKWVKANPIPADQTVWGAFSLLHEKSLADQHQLVDDAVKNADSAK
AGSIEQKIGWLYHASMDMDARNKAGFDPIKADLAGIDALKSNKDLPAWLSQSFAKGDGAV
FAFGSGADYKDAKVQIAYTEQSGLGLPTTDYYTDAKYKDIRDSYVKYLAKLFEMTGSSAA
DASKQAALAMKFETDLAQHSIPRVEMRKPENQYHFATVAEANKVTPHFDWNAFFTGQGVT
VEKGFSLSQPKFFAEFDKLVASAPMDEWKAYLKAHTISNAATALSEPFVDAQFDFYGKTL
RGQPEQQPQWKRSLNAVNGAMGQALGQLYVAKYFTPEAKARAEELVTNVRDALKTRIQNL
DWMSEETKAKALDKWSKFLPKIGYPETWRSWDGLSISKDGYYANMQAASKFNYEYDIAKI
GKPTDRKEWGMTPQTVNAYYNPTDNTINFPAAILQPPFFDAKADDAINYGGIGAVIGHEA
SHGFDDQGSQFDGDGNNVNWWTDADKKQFEARTGKLVDQFNAYAPLADHPELHVNGTLTL
GENIADLGGLNIAYDALQTALKKNPAEAGKKIEGYSEDQRFFLNWARVWRGDIREKAQMV
YLNADPHSPMKFRAMGAPSNMPTFASAFQCKPGDAMVRADDKQVKIW