Protein Info for LRK54_RS02760 in Rhodanobacter denitrificans FW104-10B01

Annotation: PepSY domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 518 signal peptide" amino acids 12 to 13 (2 residues), see Phobius details transmembrane" amino acids 14 to 35 (22 residues), see Phobius details amino acids 137 to 160 (24 residues), see Phobius details amino acids 185 to 214 (30 residues), see Phobius details amino acids 343 to 364 (22 residues), see Phobius details amino acids 385 to 407 (23 residues), see Phobius details amino acids 416 to 434 (19 residues), see Phobius details amino acids 445 to 468 (24 residues), see Phobius details amino acids 475 to 497 (23 residues), see Phobius details PF03929: PepSY_TM" amino acids 14 to 365 (352 residues), 184.4 bits, see alignment E=2.2e-58

Best Hits

KEGG orthology group: None (inferred from 64% identity to smt:Smal_2808)

Predicted SEED Role

"putative iron-regulated membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (518 amino acids)

>LRK54_RS02760 PepSY domain-containing protein (Rhodanobacter denitrificans FW104-10B01)
MKLQPATLRTFTMLHSWMGLVAGFALFVAFYAGAITVFHQPLQQWATPHTAAIGSLDDTQ
RLLDDVLARHPETREHVGMTFPGYELAQPTAYWQDHHGTWLFATPDNLAGSSTPPGANLP
ELINQLHYTLGIPVAGTWLMGVVSLLYGIALVSGFVIHLPRLAKDLFALRPGRNLKRFWQ
DAHNVIGVLSLPFHIVFAVTGALLCLMFVLMLALNPLIYEGKLMAASAAAMNTAPIMQKA
DITRPLSPLASWHARSIEVARDQGIADFAPGYLKLAHAGNAHAVVEITGTAPRGLGGGAV
ALDATSGTVLATQLPGARDANHATLAAVYALHFGDYGNVAVQWLYFLLGLGGAFLFYSGN
LLWIESRRKRRQPEQGRSSIIMARATVGICIGVCVAVSAAFVAAQLLPWLGGNAGAGERW
VCFGSWALCALWASWRAPLHAAQELLWLAALVTALIPLAHGLATGWWFWRSAAAGHGALF
AIDIGTLALAIGFGALARATARRGRTGAANSVWADQHR