Protein Info for LRK54_RS02725 in Rhodanobacter denitrificans FW104-10B01

Annotation: OsmC family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03562: peroxiredoxin, OsmC subfamily
  • amino acids 2 to 137 (136 residues), 189 bits, E=2e-60
• PF02566: OsmC
  • amino acids 40 to 136 (97 residues), 57.9 bits, E=6.1e-20

Best Hits

Swiss-Prot: 60% identical to OSMC_SHIFL: Peroxiredoxin OsmC (osmC) from Shigella flexneri

KEGG orthology group: K04063, osmotically inducible protein OsmC (inferred from 64% identity to pmk:MDS_4801)

MetaCyc: 60% identical to osmotically inducible peroxiredoxin OsmC (Escherichia coli K-12 substr. MG1655)
1.11.1.15-RXN [EC: 1.11.1.24]

Predicted SEED Role

"Osmotically inducible protein C"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.11.1.24

Protein Sequence (141 amino acids)

>LRK54_RS02725 OsmC family protein (Rhodanobacter denitrificans FW104-10B01)
MKRTASAHWSGGITDGQGTMSTDTGVLRESPFGFKSRFEDGPGTNPEELIAAAHAGCYSM
ALSLGLGNAGFTANSIDTTAVVTLLKDGDGFAITEVALTCRARVPRIDTATFDGIARATK
LACPVSKLLKATITLDARLES