Protein Info for LRK54_RS02715 in Rhodanobacter denitrificans FW104-10B01

Annotation: DUF1345 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 29 to 48 (20 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 94 to 113 (20 residues), see Phobius details amino acids 123 to 148 (26 residues), see Phobius details amino acids 203 to 226 (24 residues), see Phobius details PF07077: DUF1345" amino acids 54 to 220 (167 residues), 185.9 bits, see alignment E=2.7e-59

Best Hits

KEGG orthology group: None (inferred from 55% identity to axy:AXYL_05196)

Predicted SEED Role

"protein of unknown function DUF1345"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (230 amino acids)

>LRK54_RS02715 DUF1345 domain-containing protein (Rhodanobacter denitrificans FW104-10B01)
MDESSGRAGERAPQRRGWRPWRFVKGRRWTLLSLLIFLVALALLLHAGVRPANAVLLGFD
LAALVFLGVFARLFSRASPSHMRIQARALDTGRWGVLWGGVLLSAVVLAALGNELHAARG
GGVPALAVGVLSVVLSWLFLNVMFAVHYAHGYYGDFGEKHAGLEFPDTPEPDYWDFAYFS
IVIGMTFQVSDVQITSKYLRRVVLLHSVIAFFFNVFIIAITVNIVAGQGG