Protein Info for LRK54_RS02480 in Rhodanobacter denitrificans FW104-10B01

Annotation: elongation factor P

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00038: translation elongation factor P
  • amino acids 6 to 187 (182 residues), 249.5 bits, E=9.1e-79
• PF08207: EFP_N
  • amino acids 7 to 62 (56 residues), 81.1 bits, E=6.8e-27
• PF01132: EFP
  • amino acids 71 to 123 (53 residues), 78.7 bits, E=3.8e-26
• PF09285: Elong-fact-P_C
  • amino acids 131 to 186 (56 residues), 90.6 bits, E=6.3e-30

Best Hits

Swiss-Prot: 77% identical to EFP_XYLFA: Elongation factor P (efp) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K02356, elongation factor P (inferred from 76% identity to xal:XALc_1921)

MetaCyc: 67% identical to protein chain elongation factor EF-P (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Translation elongation factor P" in subsystem Translation elongation factors eukaryotic and archaeal

Protein Sequence (188 amino acids)

>LRK54_RS02480 elongation factor P (Rhodanobacter denitrificans FW104-10B01)
MATYGLNDVKNGVKIIVDGDPYVIVEAEFIKPGKGQAFTRIRIRNLLNGRTTEKTLKSSE
SFEGADVVDTDMQYLYSDGEFWHFMQQETFEQHQADKAAAGDAAKWLKGEEECVVTLWNG
RPIAVQPPNFVELKIVETDPGVRGDTSGGGGKPAKLETGAVVRVPLFVGQDEVIKVDTRT
GEYVSRVK