Protein Info for LRK54_RS01015 in Rhodanobacter denitrificans FW104-10B01

Annotation: class III poly(R)-hydroxyalkanoic acid synthase subunit PhaC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 355 TIGR01836: poly(R)-hydroxyalkanoic acid synthase, class III, PhaC subunit" amino acids 9 to 354 (346 residues), 531.6 bits, see alignment E=4.1e-164 PF07167: PhaC_N" amino acids 13 to 92 (80 residues), 24.5 bits, see alignment E=3e-09 PF00561: Abhydrolase_1" amino acids 68 to 334 (267 residues), 103.3 bits, see alignment E=2.6e-33

Best Hits

Swiss-Prot: 59% identical to PHAC_THIVI: Poly(3-hydroxyalkanoate) polymerase subunit PhaC (phaC) from Thiocystis violacea

KEGG orthology group: K03821, polyhydroxyalkanoate synthase [EC: 2.3.1.-] (inferred from 61% identity to xal:XALc_1638)

Predicted SEED Role

"Polyhydroxyalkanoic acid synthase" in subsystem Polyhydroxybutyrate metabolism

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (355 amino acids)

>LRK54_RS01015 class III poly(R)-hydroxyalkanoic acid synthase subunit PhaC (Rhodanobacter denitrificans FW104-10B01)
MQTPMRIDPAKVLADIATFQRKLTAGMANLRNMHEPEYANTPRELVYSEDKLKVWHFTGL
GKATAKTPLLIVYALVNTVWMTDLQADRSMVRNLLEQGEDVYLIDWGYPDGADRWLTLDD
YINGYLDRCVDAVRTRHGLEAINLLGICQGGAFSLCYTALHPDKVKNLITMVTPVDFHTP
DNMLSHWCRRMDVDLFVDTMGNIPAGLMNYVYLTLKPLRLNQQKYIGMVDILDNPVELEN
FLRMERWIFDSPDQAGEAFRQFIKDFYQGNKLVKGTLQIGGRTVDLGLITQPVLNIFAEQ
DHLVPPDASRALGKHVGTADYTQLAFKGGHIGIYVSSRAQREVPPAIHQWLRQRD