Protein Info for LRK54_RS00415 in Rhodanobacter denitrificans FW104-10B01

Annotation: translation initiation factor IF-1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 72 TIGR00008: translation initiation factor IF-1" amino acids 3 to 71 (69 residues), 127 bits, see alignment E=1.1e-41 PF01176: eIF-1a" amino acids 7 to 70 (64 residues), 99.2 bits, see alignment E=4.1e-33

Best Hits

Swiss-Prot: 83% identical to IF1_XANOR: Translation initiation factor IF-1 (infA) from Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85)

KEGG orthology group: K02518, translation initiation factor IF-1 (inferred from 85% identity to xal:XALc_1446)

Predicted SEED Role

"Translation initiation factor 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (72 amino acids)

>LRK54_RS00415 translation initiation factor IF-1 (Rhodanobacter denitrificans FW104-10B01)
MAKDDVIEMEGTVQETLPNTMFRVQLENGHVIIAHISGRMRKHYIRILTGDKVKIEMTPY
DLSKGRITYRMK