Protein Info for IAI47_21580 in Pantoea sp. MT58

Annotation: sulfonate ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13379: NMT1_2" amino acids 25 to 253 (229 residues), 50.1 bits, see alignment E=1.1e-16 TIGR01728: ABC transporter, substrate-binding protein, aliphatic sulfonates family" amino acids 31 to 311 (281 residues), 236.6 bits, see alignment E=1.7e-74 PF09084: NMT1" amino acids 54 to 236 (183 residues), 62.4 bits, see alignment E=1.8e-20 PF04069: OpuAC" amino acids 54 to 239 (186 residues), 48.5 bits, see alignment E=2.8e-16 PF00497: SBP_bac_3" amino acids 55 to 218 (164 residues), 29.6 bits, see alignment E=1.6e-10 PF12974: Phosphonate-bd" amino acids 70 to 214 (145 residues), 39.4 bits, see alignment E=1.5e-13 PF16868: NMT1_3" amino acids 92 to 202 (111 residues), 34.8 bits, see alignment E=4.1e-12

Best Hits

KEGG orthology group: K02051, sulfonate/nitrate/taurine transport system substrate-binding protein (inferred from 82% identity to ebi:EbC_20680)

Predicted SEED Role

"Alkanesulfonates-binding protein" in subsystem Alkanesulfonate assimilation or Alkanesulfonates Utilization or Putative sulfate assimilation cluster

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>IAI47_21580 sulfonate ABC transporter substrate-binding protein (Pantoea sp. MT58)
MKKVLFSAMIIAAQAGFAFNARAAAEKPDTVNIGFQKANIFALLKYRGTLDQEFKKQGIA
VHWIEFPAGPQMLEGLNIGSIDLAATGDAPPTFAQAAQADLVYLGHSPANPKTEAIVVPA
DSPIKSVADLKGKRVALNKGSDVNYLLVTALEKAGLSYKDITPVYLPPADARAAFQRGAV
DAWVIWDPYYAEVETTAKARLIKNAEGLVPHYTFYLASRKFADTYPQIAAQVVDELDTLS
SWANQHHEEAAKIMSSSTGLPQPIWQQALARMPFGAERMTPEVFTQQQALADTFTRIGLL
PVKVDIRSATWSQDKK