Protein Info for IAI47_20660 in Pantoea sp. MT58

Annotation: lycopene beta-cyclase CrtY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 386 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR01790: lycopene cyclase family protein" amino acids 5 to 373 (369 residues), 387.7 bits, see alignment E=6.6e-120 PF05834: Lycopene_cycl" amino acids 5 to 372 (368 residues), 300.8 bits, see alignment E=7.8e-94 TIGR01789: lycopene cyclase" amino acids 5 to 373 (369 residues), 558.6 bits, see alignment E=6.7e-172

Best Hits

Swiss-Prot: 73% identical to CRTY_PANAN: Lycopene beta-cyclase (crtY) from Pantoea ananas

KEGG orthology group: K06443, lycopene beta cyclase [EC: 1.14.-.-] (inferred from 91% identity to pva:Pvag_pPag30173)

MetaCyc: 73% identical to lycopene beta-cyclase (Pantoea ananatis)
RXN-12496 [EC: 5.5.1.19]; 5.5.1.19 [EC: 5.5.1.19]; 5.5.1.19 [EC: 5.5.1.19]

Predicted SEED Role

"Lycopene cyclase" in subsystem Carotenoids

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.-.-

Use Curated BLAST to search for 1.14.-.- or 5.5.1.19

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (386 amino acids)

>IAI47_20660 lycopene beta-cyclase CrtY (Pantoea sp. MT58)
MPRYDLILVGAGLANGLIALRLRQQRPSLRILLIDAESEPGAHHTWSFHAEDLTETQHHW
IAPLVVHHWPGYEVRFPQRHRSLNSGYFCVTAERFAQVIRDRFASELLLNTRVANIASRS
VTLEDGRVLDTDAVIDGRGYQSDTALRMGFQSFVGQEWQLSEPHGLTEPIIMDATVDQQA
GYRFVYSLPFSADTVLIEDTHYIDHATLEGDRARENIRDYAAQQGWKLNQLLREEQGALP
ITLTGDVAAFWQKRDLPCSGLRAGLFHPTTGYSLPLAVSLADRLAQMQTFTSETLHATIA
HFASQAWQQQRFFRMLNRMLFLAGPADQRWQVMQRFYGLPEDLIARFYAGKLTLSDRLRI
LSGKPPVPVLAALQAIMTPHRQQAMQ