Protein Info for IAI47_19735 in Pantoea sp. MT58

Annotation: sigma-70 family RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 PF07638: Sigma70_ECF" amino acids 10 to 166 (157 residues), 23.9 bits, see alignment E=6.9e-09 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 23 to 179 (157 residues), 84.7 bits, see alignment E=2.9e-28 PF04542: Sigma70_r2" amino acids 27 to 93 (67 residues), 56.8 bits, see alignment E=3.2e-19 PF08281: Sigma70_r4_2" amino acids 124 to 176 (53 residues), 52.7 bits, see alignment E=5.5e-18 PF04545: Sigma70_r4" amino acids 129 to 178 (50 residues), 45.2 bits, see alignment E=1.1e-15

Best Hits

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 90% identity to pva:Pvag_pPag30030)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>IAI47_19735 sigma-70 family RNA polymerase sigma factor (Pantoea sp. MT58)
MTKNVPHIQADLMNQIAGGDKAALEQLYRVLSPRLYGIILRMVRRRDWAEEILHDTFIHI
WQSANYYDDARSEPHIWLSHIARNRAIDFLRKHENGCCSLEEISEAEAGFQALLPADDSP
AEARRLQHCMAHLPSEQRQSISLAYYRGLSQSEIALSMSQPEGTVKSWIRRALIHLRECI
GL