Protein Info for IAI47_18875 in Pantoea sp. MT58

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 499 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details PF12146: Hydrolase_4" amino acids 120 to 240 (121 residues), 53.3 bits, see alignment E=3.7e-18 PF00561: Abhydrolase_1" amino acids 124 to 215 (92 residues), 40 bits, see alignment E=5.8e-14 PF12697: Abhydrolase_6" amino acids 125 to 277 (153 residues), 45.8 bits, see alignment E=1.8e-15

Best Hits

KEGG orthology group: None (inferred from 88% identity to pva:Pvag_pPag30520)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (499 amino acids)

>IAI47_18875 alpha/beta hydrolase (Pantoea sp. MT58)
MNRKWKTAKRRLWRLGIVTGLVLLLLLIIRIYEAERGPELKRWHTWIPHELTASQLDNAT
YADYLNAEDHLFNEMKQQVSNKLEAEDKTPLNRYYAGSMIYPGRFVQDWNRSYILRPTGT
PRGAVVLLHGLTDSPYSLRHVADVYYQQGYAVVAIRLPGHGTVPAGLTDVDWQDWMAATR
LAVREATRLAGTQTPLHLVGFSNGGALAVKYALDSLDDHTLRRPQQLILLSPMIGVTRFA
RFAGIAGLPAVFPAFSKTAWLNIVPEFNPFKYNSFPVHAARQTYLLTQALQKEIQLYARN
KQLSAFPPVLTFQSVMDSTVSTSSVIRSLYNFLPENGSELVLFDINQAVSVSPLFRHSSY
TAVNQLLPAARRRYASTVITNASATSLEMVTKSVPAGEIQEQIKPLAIDYPAGLYSLSHV
AIPFPAEDGLYGSAPAKKNEFGISFGTLSLRGESAVLIVGLDSIMRATSNPFYPYMIEQI
DHQISCSDKPPLAACLSHF