Protein Info for IAI47_17455 in Pantoea sp. MT58

Annotation: OmpA family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 570 signal peptide" amino acids 7 to 8 (2 residues), see Phobius details transmembrane" amino acids 9 to 25 (17 residues), see Phobius details amino acids 32 to 50 (19 residues), see Phobius details amino acids 200 to 217 (18 residues), see Phobius details amino acids 249 to 272 (24 residues), see Phobius details amino acids 321 to 339 (19 residues), see Phobius details PF00691: OmpA" amino acids 440 to 536 (97 residues), 57.7 bits, see alignment E=6.5e-20

Best Hits

KEGG orthology group: None (inferred from 80% identity to spe:Spro_1787)

Predicted SEED Role

"Outer membrane protein assembly factor YaeT precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (570 amino acids)

>IAI47_17455 OmpA family protein (Pantoea sp. MT58)
MSPAQQRGLALWAALLSAVICLGFLPLSRLMSVLVLLTVLGLILAILTVASRRAAQDVIL
HLDGLPEAPYRHPVVLICGDLPQAWTQPSPVLTVAQGCWIRVEDHQDLEQAARQVLWLRP
DWGRQLSVMITVCPQKHADSERLTQHLLALRWQISQLRKATGHSLPLVLNGQVGSAMMND
MLWQVAIPGESVRMWRASSAPCSIAAWITTGGLPAMQQQVLMNSLMSWFHHHVEAVFTDE
NPDVPAIAPLAMLWGMGPILAGSLATSVWTAWLSHRTAMQQVAGWQPIGSDSTILSPFPD
FVLPLLPEGEGLTSRGRSWRCALGIFTLAATAALLSSGWNNRQLLQRVSFDIARYDRIPM
QDSGPKASAVATLRDDATELDGWARNGVPARMSLGLYQGERLRMPVLDAIRSYEPPSLPP
EPQPIPQPVTKIVRLDSMSLFDSGKAVLKTGSTRMLVNSLVGIKAKPGWLIVVSGHTDNT
GNPQLNQTLSLRRAAAVRDWMRDTGDVPESCFAVQGYGESRPVATNDTPAGRALNRRVEI
SLVPQANACQIPGNTQASSQDDDVSQHNGE