Protein Info for IAI47_17180 in Pantoea sp. MT58

Annotation: LPS export ABC transporter ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 TIGR04406: LPS export ABC transporter ATP-binding protein" amino acids 3 to 241 (239 residues), 401.2 bits, see alignment E=6.4e-125 PF00005: ABC_tran" amino acids 19 to 166 (148 residues), 124.3 bits, see alignment E=5.6e-40 PF12399: BCA_ABC_TP_C" amino acids 215 to 239 (25 residues), 37.1 bits, see alignment (E = 1.9e-13)

Best Hits

Swiss-Prot: 93% identical to LPTB_ECO57: Lipopolysaccharide export system ATP-binding protein LptB (lptB) from Escherichia coli O157:H7

KEGG orthology group: K06861, lipopolysaccharide export system ATP-binding protein [EC: 3.6.3.-] (inferred from 99% identity to pao:Pat9b_0463)

MetaCyc: 94% identical to LPS export ABC transporter ATP-binding protein (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-51 [EC: 7.5.2.5]

Predicted SEED Role

"Lipopolysaccharide ABC transporter, ATP-binding protein LptB" in subsystem KDO2-Lipid A biosynthesis

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.5.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>IAI47_17180 LPS export ABC transporter ATP-binding protein (Pantoea sp. MT58)
MATLIAENLAKAYKGRRVVEDVSLQVKSGEIVGLLGPNGAGKTTTFYMVVGIVPRDAGRI
IIDDEDISILPLHARARRGIGYLPQEASIFRRLSVYDNLMAVLQIRDDLTEEQRQDRARE
LMEEFHIEHLRDSMGQALSGGERRRVEIARALAANPKFILLDEPFAGVDPISVIDIKKII
EHLRDSGLGVLITDHNVRETLAVCERAYIVSQGHLIAHGTPNEILADEQVKRVYLGEEFR
L