Protein Info for IAI47_15220 in Pantoea sp. MT58

Annotation: methylthioribulose 1-phosphate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 PF00596: Aldolase_II" amino acids 9 to 194 (186 residues), 145.8 bits, see alignment E=7e-47 TIGR03328: methylthioribulose-1-phosphate dehydratase" amino acids 10 to 199 (190 residues), 222.3 bits, see alignment E=2e-70

Best Hits

Swiss-Prot: 74% identical to MTNB_CROS8: Methylthioribulose-1-phosphate dehydratase (mtnB) from Cronobacter sakazakii (strain ATCC BAA-894)

KEGG orthology group: K08964, methylthioribulose-1-phosphate dehydratase [EC: 4.2.1.109] (inferred from 100% identity to pva:Pvag_0264)

Predicted SEED Role

"Methylthioribulose-1-phosphate dehydratase (EC 4.2.1.109)" in subsystem Methionine Salvage (EC 4.2.1.109)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.109

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>IAI47_15220 methylthioribulose 1-phosphate dehydratase (Pantoea sp. MT58)
MSQSLPLDQLVAACHWIGEKGWAPATGGNMSVRRDEHVCLLSESGKDKGTLTRDDFIEVD
IATSQSLSGRKPSAETGLHTMIYRLFPEAGAVLHTHTVNSTVLSRVEQGAALLLHGYEMQ
KSLSGQHTHLDTLAIPVFDNSQDIAALASEIEDYAARFPLRYGFLLRGHGLTCWGRDVSE
ARRHLEGLEFLFECERQRRLLEKA