Protein Info for IAI47_12025 in Pantoea sp. MT58

Annotation: glycoside hydrolase family 88 protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 PF07470: Glyco_hydro_88" amino acids 38 to 377 (340 residues), 367.8 bits, see alignment E=2.8e-114

Best Hits

KEGG orthology group: None (inferred from 96% identity to pva:Pvag_0903)

Predicted SEED Role

"Rhamnogalacturonides degradation protein RhiN" in subsystem D-Galacturonate and D-Glucuronate Utilization or L-rhamnose utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>IAI47_12025 glycoside hydrolase family 88 protein (Pantoea sp. MT58)
MTVFPVKHSKLLCQPEYLLPRSELVQLIQKLTQNLVNITDETGEFLLRLDDGRVIDTKGW
AGWEWTHGIGLYGMLHYYQQTGDAQTLAIIDRWFTQRLAEGTPTKNVNTVCPFLTLAYRY
EETRNPAWVPVLERWAEWVMYEMPRTEQGGLQHIVYNNENTQQLWDDTLMMSVMALAKIG
QLLKRDEWVEEASYQFLLHTQYLMDRETGLWFHGWNFDGRHNFANARWARGNSWVTIVIP
DFLEMMNWPEHHATRRFLQQVLESQVNALKACQHSSGLWHTLLDDPHSYPEASATAGFAY
GILKAVRKRYLPAAYREVAEKALRGVIANIDEDGELMQVSFGTAMGSDLDYYRTVPLTSM
PYGQAMALLCLTEYLRVYL