Protein Info for IAI47_10820 in Pantoea sp. MT58

Annotation: MATE family efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 457 signal peptide" amino acids 1 to 30 (30 residues), see Phobius details transmembrane" amino acids 53 to 72 (20 residues), see Phobius details amino acids 92 to 110 (19 residues), see Phobius details amino acids 129 to 147 (19 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 187 to 212 (26 residues), see Phobius details amino acids 241 to 264 (24 residues), see Phobius details amino acids 278 to 301 (24 residues), see Phobius details amino acids 313 to 336 (24 residues), see Phobius details amino acids 350 to 367 (18 residues), see Phobius details amino acids 387 to 407 (21 residues), see Phobius details amino acids 419 to 438 (20 residues), see Phobius details PF01554: MatE" amino acids 17 to 177 (161 residues), 129.2 bits, see alignment E=1.2e-41 amino acids 244 to 405 (162 residues), 124.6 bits, see alignment E=3.2e-40 TIGR00797: MATE efflux family protein" amino acids 17 to 422 (406 residues), 391.3 bits, see alignment E=2.3e-121 PF14667: Polysacc_synt_C" amino acids 131 to 262 (132 residues), 36.7 bits, see alignment E=4.4e-13

Best Hits

Swiss-Prot: 80% identical to MDTK_KLEP7: Multidrug resistance protein MdtK (mdtK) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K03327, multidrug resistance protein, MATE family (inferred from 98% identity to pva:Pvag_1166)

MetaCyc: 77% identical to multidrug efflux pump MdtK (Escherichia coli K-12 substr. MG1655)
RXN0-2561; TRANS-RXN-347; TRANS-RXN-348; TRANS-RXN-349

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (457 amino acids)

>IAI47_10820 MATE family efflux transporter (Pantoea sp. MT58)
MQKYLTEARQLLALAIPVILAQVAQTAMGFVDTIMAGAVSATDMAAVAVGTSVWLPAILF
GHGLLLALTPTVAQLNGSGRRERIGEQIRQGYWLAFFVSLLIMVLLWHAGYLIRAMHDID
PALALKAEGYLHALLFGAPGYLFFQVLRNQCEGLSKTKPGMVLGFLGLMFNIPLNYVFIY
GHFGMPALGGVGCGVATASVYWVMFICMRFWVRRMGSMRDIRLESRWSPPSRPILSRLMT
LGLPVALALFFEVTLFAVVALLVSPLGIVNVAGHQIALNFSSLMFVLPLSLGVATTIRVG
YRLGQGSTEQARVAAWTAQGVGISMAALTAIFTVTFRHQIALLYNDNSEVVTLAAQLMLL
AAIYQFSDSIQVIGSGILRGYKDTRSIFFITFIAYWLLGLPAGYLLALTDWIVPRMGPAG
FWCGFIIGLTSAALMMLWRIRRLQQLPADIILTRAAR