Protein Info for IAI47_08065 in Pantoea sp. MT58

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 342 transmembrane" amino acids 7 to 24 (18 residues), see Phobius details amino acids 34 to 53 (20 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 126 to 146 (21 residues), see Phobius details amino acids 152 to 171 (20 residues), see Phobius details amino acids 185 to 204 (20 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 238 to 259 (22 residues), see Phobius details amino acids 266 to 284 (19 residues), see Phobius details amino acids 304 to 323 (20 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 10 to 320 (311 residues), 71.4 bits, see alignment E=3.6e-24

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (342 amino acids)

>IAI47_08065 acyltransferase (Pantoea sp. MT58)
MNEIKPLTSIRGLFALYVAIYHIFPRTNAFLSNGYLSVDLFFVLSGFIMSYVYKVKFSST
INIKTYLTYLNGRFARVYPLYAFMIILTTFFYFKNKIPLPNTTEYIILFSFLQSIMDVTN
NLIPHAWSISVEFIAYLTFPFAIFLLSKKHGIISLVVITASAFTGLYLASLKGYWGPLDV
VGGKFAIVRCLSDYVLGIVSLFVFQMVKEKFKWITLEIALIFSIALAFTTLNFRGYDLLV
VVFFTIMIPLLSASQGIIYKLMSLSPIVYLGEISYSIYLIHYPLCRRLSFIPAWFHNKLP
FIDFNYIALIITISISILTYHFIEVPFRKFIRGSPKRTNVRV