Protein Info for IAI47_07620 in Pantoea sp. MT58

Annotation: FAD-binding oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 443 PF01494: FAD_binding_3" amino acids 18 to 48 (31 residues), 23.3 bits, see alignment (E = 9.2e-09) PF01266: DAO" amino acids 19 to 413 (395 residues), 236.4 bits, see alignment E=1.8e-73 PF00890: FAD_binding_2" amino acids 19 to 222 (204 residues), 30.5 bits, see alignment E=5.8e-11 PF01134: GIDA" amino acids 19 to 47 (29 residues), 26.9 bits, see alignment (E = 6.4e-10) PF13450: NAD_binding_8" amino acids 22 to 49 (28 residues), 29.7 bits, see alignment (E = 1.6e-10)

Best Hits

KEGG orthology group: None (inferred from 96% identity to pva:Pvag_1881)

Predicted SEED Role

"D-amino acid dehydrogenase small subunit (EC 1.4.99.1)" in subsystem Pyruvate Alanine Serine Interconversions or Respiratory dehydrogenases 1 (EC 1.4.99.1)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.99.1

Use Curated BLAST to search for 1.4.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (443 amino acids)

>IAI47_07620 FAD-binding oxidoreductase (Pantoea sp. MT58)
MPAPIRYVQDSANFPDSADVVVIGAGIAGAAATWELAKQGVKVVLIEKGLVGAEQSSRNW
GWCRQQNRDERELPLIIYALQRWGELNDETGEELGFRRSGLVYATQEESDIAAWDKWIQM
AKGYGVNSSILTAEQAKAMTPGSTTPWRGGLSAPTDGHAEPRLAAPGLVAGALKKGAMLF
QQCAVRGLDIAGGRVSGVWTERGLIKTSRVICAGGAWTSMFCRRHGIDLPLGNVIGTAFR
TQPIEQAIAMPLYTPGFACRPQMDGSYTVSVSGRGRLEPGAQGLRYARQFYPTFKSRRKN
LTLNLGLSPFFNGPEAMGGWAFDRESPFERMRILDPAADAKIVEEGLAAMRREYPALANL
RLAQSWGGMIDSTPDAIPVISTVAKLPGLVLSAGYSAHGFGIGPGAGRLAADLATEATPI
VDPTPYRYSRLVDGSGLETPGMM