Protein Info for IAI47_07050 in Pantoea sp. MT58

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details TIGR01096: lysine-arginine-ornithine-binding periplasmic protein" amino acids 9 to 255 (247 residues), 275.2 bits, see alignment E=2.6e-86 PF00497: SBP_bac_3" amino acids 31 to 256 (226 residues), 207.1 bits, see alignment E=1.2e-65

Best Hits

Swiss-Prot: 52% identical to ARGT_SALTY: Lysine/arginine/ornithine-binding periplasmic protein (argT) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K10013, lysine/arginine/ornithine transport system substrate-binding protein (inferred from 97% identity to pva:Pvag_1960)

Predicted SEED Role

"Lysine-arginine-ornithine-binding periplasmic protein precursor (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>IAI47_07050 ABC transporter substrate-binding protein (Pantoea sp. MT58)
MNIFTQRLRQTLAVAVMAGCAFGAQAKIEQVRFAVDPTYPPFESKTPQGKLVGFDIDLGN
ALCTQMQAKCVWVESQFDGMIPALKARKFDAILSDMGITEERLKQINFTVPLYDTHTQLI
ARKGSGILPTVESLKGKTVGVEQGTVQERYALAKWQPHGVTVVPYGDQAQVESDLVSGRL
DAVFTDAAQAAIGFLKHPQGKDFELAGPIIQDPIIGPGTAIGLRKGDEELKTALDNAFAE
IKKNGTFDQIQKRYFATDISIQQ