Protein Info for IAI47_06715 in Pantoea sp. MT58

Annotation: YbfB/YjiJ family MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 375 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 34 to 57 (24 residues), see Phobius details amino acids 73 to 90 (18 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 205 to 226 (22 residues), see Phobius details amino acids 234 to 256 (23 residues), see Phobius details amino acids 267 to 284 (18 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 323 to 348 (26 residues), see Phobius details amino acids 355 to 371 (17 residues), see Phobius details PF07690: MFS_1" amino acids 13 to 339 (327 residues), 68 bits, see alignment E=7.5e-23 PF06779: MFS_4" amino acids 14 to 370 (357 residues), 285.2 bits, see alignment E=1e-88

Best Hits

KEGG orthology group: None (inferred from 97% identity to pva:Pvag_2030)

Predicted SEED Role

"Possible MFS Superfamily transporter precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (375 amino acids)

>IAI47_06715 YbfB/YjiJ family MFS transporter (Pantoea sp. MT58)
MALRVALSAFLTLFVAMGIGRFAFTPQVPLMIQAHQLTLTSASLVAALNYLGYLCGSFDA
MRAHQRVELRLQAGVWGAVILTLLSALATGPWLHGAIRFLIGWASGWAMVLVAAWSNEQL
HRHGRAGLSAAVFAGPGCGIFVSGLLGVALHTFQVSAGLAWAAYGALALLLIALITRNLP
RRGELHRPDQAPEPLVLNRNLKRLVLSYSLAGFGYILPATFLSQMAATRFPDGIFAQFVW
PIFGGAAMIGILLGILTRRWGHSHVRLALVLWAQALGVFAAALLPGFSGLLAGALLVGGG
FLSVVQLSMLCARELAPNHLRFMAGLLTTGYAIGQLVGPLLSFLSTALLHRLEPALWVAG
VSLVWAGLLVWRRIE