Protein Info for IAI47_05250 in Pantoea sp. MT58

Annotation: GGDEF domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 521 signal peptide" amino acids 1 to 13 (13 residues), see Phobius details transmembrane" amino acids 14 to 33 (20 residues), see Phobius details amino acids 289 to 310 (22 residues), see Phobius details PF02743: dCache_1" amino acids 43 to 266 (224 residues), 61.8 bits, see alignment E=7e-21 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 361 to 519 (159 residues), 158 bits, see alignment E=8.8e-51 PF00990: GGDEF" amino acids 364 to 514 (151 residues), 142.7 bits, see alignment E=9.2e-46

Best Hits

KEGG orthology group: None (inferred from 94% identity to pva:Pvag_2239)

Predicted SEED Role

"GGDEF family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (521 amino acids)

>IAI47_05250 GGDEF domain-containing protein (Pantoea sp. MT58)
MLKHIRPKADLRNLIALLVIVSIVITLANALYATWRVQRQVLIDTTLEANRAYAAKLAST
SEIFFQLAQSQLHYSANQLSRDFTNQGLLNNEVNRLREQTTSFNSVAIVDAQGVIKAISP
ESLTLQGMHLTSDASREALTLRQPIISKPSLSAANNLLVFVSWPVWSPEGDYLGYIGGTI
YLKKKSILNALLGEQFYRDGTTVYVLDSNNEVLYHQNRQLIGKTLPAIVNPRDDQTNGSL
MLAGPGNATQLAGFAVVPTTGWTVVALKPINVTLDPLSGLLMKVLKNSVPFALLTLLVAL
VMARLIARPLFQLARKASRMDAQGVSKEIGGITAWYFEAAQVKRALLTGIGLVQDKIGRL
NSEAQTDPLTQVLNRRGLNAVLEYYRTLRQPFSVLALDIDHFKNVNDSWGHDVGDRVIQQ
VASTLRASARQSDVVCRNGGEEFLMLLPGTALDEAQIIAERVRVGIAEAWLTDVGRITLS
IGVAAWNGSQDAGLENSLKQADAALYEAKSAGRNCVIVADS