Protein Info for IAI47_04475 in Pantoea sp. MT58

Annotation: bifunctional acetate--CoA ligase family protein/GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 891 PF13380: CoA_binding_2" amino acids 13 to 130 (118 residues), 81.3 bits, see alignment E=1.9e-26 PF13607: Succ_CoA_lig" amino acids 147 to 279 (133 residues), 146.8 bits, see alignment E=9e-47 PF13549: ATP-grasp_5" amino acids 472 to 694 (223 residues), 247.6 bits, see alignment E=2.4e-77 PF13302: Acetyltransf_3" amino acids 727 to 863 (137 residues), 28.8 bits, see alignment E=4.6e-10 PF00583: Acetyltransf_1" amino acids 760 to 863 (104 residues), 30.6 bits, see alignment E=9.1e-11

Best Hits

Swiss-Prot: 77% identical to LYSAC_ECOLI: Peptidyl-lysine N-acetyltransferase PatZ (patZ) from Escherichia coli (strain K12)

KEGG orthology group: K09181, hypothetical protein (inferred from 81% identity to ebi:EbC_34540)

MetaCyc: 77% identical to peptidyl-lysine N-acetyltransferase (Escherichia coli K-12 substr. MG1655)
2.3.1.-

Predicted SEED Role

"Protein acetyltransferase" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (891 amino acids)

>IAI47_04475 bifunctional acetate--CoA ligase family protein/GNAT family N-acetyltransferase (Pantoea sp. MT58)
MSQRGLEALLRPKSIAVIGASVTPGRAGYFMMRNLLAGGFSGPVLPVTPKYKAVSGVLAW
PTIDSLPFAPDLAVICTHSKRNLELLQQLGEKGCKACIILSAPASQSAELKACAGKWQIR
LLGPNSLGLLAPWQGLNASFSPVPIEKGRIAFISQSAAVSNTILDWAQQRNLGFSWFIAL
GDSLDTDVDDLLDFLARDGKTSAILLYLEHLSDARRFVSASRSASRNKPILIIKSGRSRE
AQALLGTHSGLDAAWDAAIQRAGLLRVQDTHELFSAVESLSHMRPLRGDRLMIISNGAAP
AALALDELYARNGKLAQLSDETRQQLEALLPAGAGRGNPLDLKDDATAERYAACVEILLN
SHELDALMIIHAPSAVAPATETAAHLIDTIARHPRGKLVTLLTNWSGEFSSQAARRAFTQ
AGIPTWRTPEGTVTAFMHQVEYRRNQKQLRETPALPTTLKQDSAQAHQLLSQALSRGVTA
LDTHEVQPVLQAYGLATLPTWIASDSTSAVAIADQIGYPVALKLRSPDIAHKSEVQGVML
YLRNASEVEHAAEAIFDRVRQTLPQARIEGLLVQSMASRAGAQELRVVVEQDALFGPIIM
LGEGGVEWQADKQAAVALPPLNMTLARYLVIQAIKSGKIRSRSALNPLDIPGLSQLLVQV
SNLVVDCPEIQRLDIHPLLAAGNDFTLLDVTLTLAPFDGDNEARLAIRPYPQHLEEQVEL
KNGQFCLFRPILPEDEPLLRDFISQVTKEDLYYRYFSEINEFTHDDLANMTQIDYDREMA
IVAVRQHQGRPEIIGVTRAISDADNIDAEFSVLVRSDLKGLGMGRRLLEKMIRYTRHHGL
QQLNGITMPHNRGMITLARKLNFHVDIQLDDGIVSLKLSLQNEINPPCRER