Protein Info for HSERO_RS23935 in Herbaspirillum seropedicae SmR1

Annotation: glucan biosynthesis protein D

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 517 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details PF04349: MdoG" amino acids 23 to 506 (484 residues), 622.5 bits, see alignment E=3e-191

Best Hits

Swiss-Prot: 61% identical to OPGG_PSEAE: Glucans biosynthesis protein G (opgG) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K03670, periplasmic glucans biosynthesis protein (inferred from 100% identity to hse:Hsero_4784)

Predicted SEED Role

"Glucans biosynthesis protein G precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IZ41 at UniProt or InterPro

Protein Sequence (517 amino acids)

>HSERO_RS23935 glucan biosynthesis protein D (Herbaspirillum seropedicae SmR1)
MVSATLSACLLAASAQAQTSQGFDLNQAVARAKDLAAKPYQKPVSNLSPTFAAMQFADYM
KIQPKSEKFEWRDQKTPFKLAFYHQGMQFNAPVAIHEIIDGRVQDVGYSTDRFNFGDLNL
AKDSTAHLGYAGFRVVYPINRDDKEDEVMSVLGASYFRVIGKGQVYGLSARGLAIDTAMM
SGEEFPHFTEFWIQRPAPGEKQLTFYALLDSPRATGAYKFTLTPGKDALLDVQARVFLRG
EVGRLGIAPLTSMFLFGPNQQSSRRNFRPAIHDSNGLAIHTGNGEWLWRPLNDPQNVEVS
SFEVSNPRGFGLLQRGREFSAYEDLKDRYDLRPSAWIEPKGDWGKGAVQLVEIPTADETN
DNIVAYWLPAQLPARGTPLAYDYRIHWTMDEPAILNNEVGWVKQTFHTDGELTQANLIRA
FDGTTALLVDFTGGPLGALPAGTPVQPQVSVSNNGELIDVQLQPNPAINGWRLTLRVKIR
NVAQAVELRAALSANGKPLTETWSYQLPPRSDVQRTF