Protein Info for HSERO_RS23720 in Herbaspirillum seropedicae SmR1

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 492 transmembrane" amino acids 29 to 50 (22 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details PF00672: HAMP" amino acids 215 to 264 (50 residues), 36.5 bits, see alignment 7.5e-13 PF00512: HisKA" amino acids 270 to 331 (62 residues), 46.4 bits, see alignment E=5.1e-16 PF02518: HATPase_c" amino acids 382 to 491 (110 residues), 75 bits, see alignment E=9.7e-25

Best Hits

KEGG orthology group: K07711, two-component system, NtrC family, sensor histidine kinase YfhK [EC: 2.7.13.3] (inferred from 100% identity to hse:Hsero_4741)

Predicted SEED Role

"Putative sensor-like histidine kinase YfhK" in subsystem Orphan regulatory proteins

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IY80 at UniProt or InterPro

Protein Sequence (492 amino acids)

>HSERO_RS23720 histidine kinase (Herbaspirillum seropedicae SmR1)
MLNAIEHHPTPHAAPARPSGYLGLSFRQLLLAAFLLIAALLSGTSIHALFTLDRMSANSR
ETARQAVQLTEAAQRLAERTVAMERSARQYLVLDDPAFHDRFNEARDQARQALGELADSL
PKAPREMFGQWSVYVDEAAGVLDADSRKDKGEQARLFQDFARLPALNERIALESRREVDR
RNNALSAALEQQRQMLTAQVVGAIVLAVLLAFCFGLWLSRPMARLEQAIGRLGDNRFDQP
IDVRGPADIRRLGQQLDWLRQRLADLEAEKSRFLRHVSHELKTPLAALCEGAALLDDGVA
GQLTDSQREIARILRQNTQSLQTQIEDLLRYNEVSFDAQRIHPVPVDLRALLHKVIDDQR
LQWLARELKVEIEGAARTVVVDPEKMAIVLANLLSNAVRFSPQGGFIRFLLSEAPGLVRV
ECVDQGPGVAPTDAARIFEPFYQGLNQPTAARRGNGIGLSVVREYVQAHSGKVYLVPREG
GAHFRIELPDEK