Protein Info for HSERO_RS23675 in Herbaspirillum seropedicae SmR1

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 467 transmembrane" amino acids 13 to 35 (23 residues), see Phobius details amino acids 175 to 195 (21 residues), see Phobius details PF08521: 2CSK_N" amino acids 24 to 171 (148 residues), 131.9 bits, see alignment E=3.7e-42 PF00512: HisKA" amino acids 249 to 310 (62 residues), 38.2 bits, see alignment E=2.5e-13 PF02518: HATPase_c" amino acids 360 to 450 (91 residues), 62.9 bits, see alignment E=7.4e-21

Best Hits

KEGG orthology group: K07649, two-component system, OmpR family, sensor histidine kinase TctE [EC: 2.7.13.3] (inferred from 100% identity to hse:Hsero_4732)

Predicted SEED Role

"Tricarboxylate transport sensor protein TctE"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IY76 at UniProt or InterPro

Protein Sequence (467 amino acids)

>HSERO_RS23675 histidine kinase (Herbaspirillum seropedicae SmR1)
VAHLFSRRRSVRAYLLAWIISPIALFIIIDSFSLYRNTLESVNTAYDRMLIASVHSIGDL
LRIENGELKASLPYAALEIYEADYSSRMIYRINGLDGKFFDGDADLPSYKGKADKEAIYP
ALAHIYEDTYNGVPVRVAALFQPVVTNDPRGAALVQVAETMENRSALARKIFWETLIRQA
ALLVVIVSVTLYVVRRALQPVDALRRQLDERPADDLSPVAPPMAPRELQPFIDALNQLMA
RLRRLLDHQQRFVANASHQLRTPLAVLKTQLQSGLRGDAPAPVIWQEMSGTVERATTLAN
QLLSLAKVEQIRGRGAQEVCDLGMLARETAVDLSPLIAEKDLDFELEAEKILVMGHPWMI
GELISNLLHNAIRHTPAQGRLGIRITAREDVAELLIWDSGEGIDDQAMENVFKAFSSNVS
SAGGLGLTICGEIVDSMQATISLRNRVGEDGTIEGLNASVHVRVVAG