Protein Info for HSERO_RS23640 in Herbaspirillum seropedicae SmR1

Annotation: Ni/Fe hydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 43 to 66 (24 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 100 to 119 (20 residues), see Phobius details amino acids 124 to 141 (18 residues), see Phobius details amino acids 153 to 177 (25 residues), see Phobius details amino acids 185 to 202 (18 residues), see Phobius details PF04955: HupE_UreJ" amino acids 18 to 200 (183 residues), 196.4 bits, see alignment E=3e-62

Best Hits

KEGG orthology group: K03192, urease accessory protein (inferred from 100% identity to hse:Hsero_4725)

Predicted SEED Role

"HupE-UreJ family metal transporter" in subsystem Transport of Nickel and Cobalt or Urea decomposition

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IY69 at UniProt or InterPro

Protein Sequence (203 amino acids)

>HSERO_RS23640 Ni/Fe hydrogenase (Herbaspirillum seropedicae SmR1)
MLTLSTKTRARLGVLAVTALAAGTALAHPGHPGSAMDASASMAAGFAHPFSGIDHLLAML
AVGLWAAQNKQRALWVLPLAFPLMMVAGALLAFAGLQVPAVETGIAASVAVLGLLIAFAV
RMPLWGSTLVVSLFAMFHGYAHGAELPHGSSAAMYGAGFIAATALLHAAGLGIGLIAGQQ
MADRVVRIGGVGIAAVGAYLLAA