Protein Info for HSERO_RS23040 in Herbaspirillum seropedicae SmR1

Updated annotation (from data): D-galacturonate dehydrogenase (EC 1.1.1.203)
Rationale: Specifically important in carbon source D-Galacturonic Acid monohydrate. Also see related proteins URODH_PSESM and URODH_PSEPK in Swiss-Prot.
Original annotation: NAD-dependent dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 17 to 185 (169 residues), 40 bits, E=7.7e-14
• PF16363: GDP_Man_Dehyd
  • amino acids 19 to 178 (160 residues), 51.5 bits, E=3.3e-17
• PF01370: Epimerase
  • amino acids 19 to 186 (168 residues), 83.4 bits, E=5.1e-27
• PF01073: 3Beta_HSD
  • amino acids 20 to 162 (143 residues), 52.2 bits, E=1.4e-17
• PF13460: NAD_binding_10
  • amino acids 22 to 131 (110 residues), 37.6 bits, E=6.6e-13
• PF07993: NAD_binding_4
  • amino acids 73 to 186 (114 residues), 31.6 bits, E=3e-11

Best Hits

Swiss-Prot: 68% identical to URODH_PSESM: Uronate dehydrogenase (udh) from Pseudomonas syringae pv. tomato (strain ATCC BAA-871 / DC3000)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_4608)

MetaCyc: 68% identical to uronic acid dehydrogenase subunit (Pseudomonas syringae)
Uronate dehydrogenase. [EC: 1.1.1.203]; 1.1.1.203 [EC: 1.1.1.203]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (9/11 steps found)
• D-glucuronate degradation III (2/2 steps found)
• D-glucuronate degradation II (4/5 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (5/7 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• D-galacturonate degradation III (1/2 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• D-galacturonate degradation II (3/5 steps found)
• D-galactose detoxification (1/3 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (2/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of microbial D-galacturonate and D-glucuronate degradation (16/31 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 1.1.1.203 or 5.1.3.2

Sequence Analysis Tools

See D8IX37 at UniProt or InterPro

Protein Sequence (284 amino acids)

>HSERO_RS23040 D-galacturonate dehydrogenase (EC 1.1.1.203) (Herbaspirillum seropedicae SmR1)
MSQDQDVAAWQTARFSRLLLTGAAGGVGKQLRARLASFAEVVRVADLASAMAAVDPAAAH
EEALGCDLADRAAVDAMVAGCEAIIHLGGVSVERPFEEILEANIKGVFHIYEAARRHGVK
RVIFASSNHVTGFYGQDERIDARDMKRPDGYYGLSKSYGEDMAQFYFDRYGVETVSIRIG
SIFPEATNRRMLASWMSMDDFEQLLRRSLFIPDVGHTIVYGMSANAKTWWDNRYAAHLGY
APKDSSEIFRAKVEAQPMPAPDDPVLTLQGGAFTTAGPFDPLAD