Protein Info for HSERO_RS23035 in Herbaspirillum seropedicae SmR1

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 transmembrane" amino acids 20 to 45 (26 residues), see Phobius details amino acids 65 to 84 (20 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details amino acids 147 to 168 (22 residues), see Phobius details amino acids 190 to 213 (24 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 14 to 111 (98 residues), 99.7 bits, see alignment E=5.4e-33 PF00528: BPD_transp_1" amino acids 35 to 212 (178 residues), 76.3 bits, see alignment E=1.3e-25

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_4607)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IX36 at UniProt or InterPro

Protein Sequence (277 amino acids)

>HSERO_RS23035 ABC transporter permease (Herbaspirillum seropedicae SmR1)
MNFSLDFSPLAPYWPVFLHGAWLTLKMTTLAVIVGVAIGIFVAFAKNSPHRWLARGCSAY
IEVVRNTPFLVQIFLLYFGLASLGIRMPTFAAAVLAMIINIAAYAAEIIRAGLDSVPRGQ
IEAAQCLGLSVWRIRWHVMLQPAIERVYPALTSQFLLMMQASAMASQISAEELTAIANTV
QSDTFRSLETYLVVAALYLVLAILVKLVAYAIGETIFKRRRTLRRAAAQGRRTPVSRLPA
TDPAAMAPLAHVPYVHPASRPVAVNTAASLRIEGSAS