Protein Info for HSERO_RS23010 in Herbaspirillum seropedicae SmR1

Updated annotation (from data): D-galacturonate transporter ExuT
Rationale: Specifically important for D-galacturonate utilization.
Original annotation: hexuronate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 408 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 38 to 59 (22 residues), see Phobius details amino acids 66 to 86 (21 residues), see Phobius details amino acids 93 to 112 (20 residues), see Phobius details amino acids 125 to 149 (25 residues), see Phobius details amino acids 155 to 175 (21 residues), see Phobius details amino acids 254 to 277 (24 residues), see Phobius details amino acids 292 to 310 (19 residues), see Phobius details amino acids 316 to 337 (22 residues), see Phobius details amino acids 349 to 373 (25 residues), see Phobius details amino acids 379 to 400 (22 residues), see Phobius details PF07690: MFS_1" amino acids 6 to 281 (276 residues), 172.7 bits, see alignment E=1.1e-54 amino acids 289 to 405 (117 residues), 36.9 bits, see alignment E=2.2e-13

Best Hits

KEGG orthology group: K08191, MFS transporter, ACS family, hexuronate transporter (inferred from 100% identity to hse:Hsero_4602)

Predicted SEED Role

"Hexuronate transporter" in subsystem Alginate metabolism or D-Galacturonate and D-Glucuronate Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IX31 at UniProt or InterPro

Protein Sequence (408 amino acids)

>HSERO_RS23010 D-galacturonate transporter ExuT (Herbaspirillum seropedicae SmR1)
MVTLVTLALIVNYLARNTLSVAAPTMMKELDMSTQQYSYIVVAWQICYAVMQPVAGYILD
AVGTKIGFGIFALAWSLVCAAAAFATGWQSLAFFRALLGITEAAGIPGGVKASTEWFPAK
ERSVAIGWFNIGSSIGALCAPPLVVWTILHGGWKMSFVVVGALGVIWFVLWMLFYKSPRD
QKLLSPEERAYILEGQEKSPEKVQRESWTKIVRSRNFWSIAIPRFLSEPAWQTFNAWIPL
YMATERHMNIKEIAMFAWLPFLAADIGCVLGGYLSPLFHKHLKVSLFTSRKLVMLVGSLS
MIGPACVGFVDSPYVAIALLSIGGFAHQTLSGALYSITSDVFTKNQVATATGLTGMSGYL
GATLFTLLFGILVTQIGYGPLFVLLAAFDLVAVAVVFAIARPRPEAIA