Protein Info for HSERO_RS22875 in Herbaspirillum seropedicae SmR1

Annotation: cysteine hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

No protein families (PFam or TIGRFam), signal peptides, or transmembrane helices were found in this protein.

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_4578)

Predicted SEED Role

"Nicotinamidase (EC 3.5.1.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 3.5.1.19)

MetaCyc Pathways

• NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
• aldoxime degradation (3/3 steps found)
• NAD salvage pathway V (PNC V cycle) (4/5 steps found)
• NAD salvage (plants) (6/11 steps found)
• superpathway of NAD biosynthesis in eukaryotes (7/14 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.19

Sequence Analysis Tools

See D8IX07 at UniProt or InterPro

Protein Sequence (287 amino acids)

>HSERO_RS22875 cysteine hydrolase (Herbaspirillum seropedicae SmR1)
MKRSLHLLVIDPQNDFCDLPASWLPVDPASGGALQPALPVAGSHADLQRVAGLIDQGGAG
LSAISITLDAHHRLDIAHPTFWRQGDGSAVTPFTQIEAAQVRAGLYLPRDPQSLPRALAY
LDALEAAGRYRLMVWPVHCEIGSWGAAVHADVRAAYNRWEERTLGVVTKLGKGSNPWTEH
YSAVMAEVPDDDDPATQLNRGFIATLAQADTVYITGEAGSHCVRATTEHIAANLDAAGRA
RLVLVTDCMSPVAGFEAQYQDFLAAMSQAGVRLATSAQVLQELQANA