Protein Info for HSERO_RS22795 in Herbaspirillum seropedicae SmR1

Annotation: N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13420: Acetyltransf_4
  • amino acids 3 to 154 (152 residues), 58.3 bits, E=3.4e-19
• PF13302: Acetyltransf_3
  • amino acids 3 to 137 (135 residues), 47.2 bits, E=1.3e-15
• PF00583: Acetyltransf_1
  • amino acids 17 to 136 (120 residues), 80.9 bits, E=3.2e-26
• PF13673: Acetyltransf_10
  • amino acids 40 to 140 (101 residues), 45.4 bits, E=2.9e-15
• PF13508: Acetyltransf_7
  • amino acids 52 to 138 (87 residues), 52.3 bits, E=2.2e-17
• PF12746: GNAT_acetyltran
  • amino acids 76 to 139 (64 residues), 28 bits, E=5.8e-10
• PF08445: FR47
  • amino acids 84 to 138 (55 residues), 40.4 bits, E=8.6e-14

Best Hits

Swiss-Prot: 63% identical to MNAT_ECOLI: L-amino acid N-acyltransferase MnaT (mnaT) from Escherichia coli (strain K12)

KEGG orthology group: K03823, phosphinothricin acetyltransferase [EC: 2.3.1.183] (inferred from 100% identity to hse:Hsero_4562)

MetaCyc: 63% identical to L-amino acid N-acyltransferase (Escherichia coli K-12 substr. MG1655)
Amino-acid N-acetyltransferase. [EC: 2.3.1.1]

Predicted SEED Role

"GCN5-related N-acetyltransferase"

MetaCyc Pathways

• L-arginine biosynthesis II (acetyl cycle) (10/10 steps found)
• superpathway of arginine and polyamine biosynthesis (15/17 steps found)
• L-arginine biosynthesis I (via L-ornithine) (9/9 steps found)
• L-arginine biosynthesis III (via N-acetyl-L-citrulline) (8/9 steps found)
• L-ornithine biosynthesis I (5/5 steps found)
• phosalacine biosynthesis (2/25 steps found)
• phosphinothricin tripeptide biosynthesis (2/25 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Urea cycle and metabolism of amino groups

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.1, 2.3.1.183

Use Curated BLAST to search for 2.3.1.1 or 2.3.1.183

Sequence Analysis Tools

See D8IWZ1 at UniProt or InterPro

Protein Sequence (173 amino acids)

>HSERO_RS22795 N-acetyltransferase (Herbaspirillum seropedicae SmR1)
MQIRDAELADIAGITPIYNDAVANTTAIWNETLVDDRNREDWLTARRQSGYPVLVAVADG
KVLGYASFGDWRAFDGYRHTVEHSVYVHKDHRGEGLGRALMEALIARARALGKHVMVAGI
DASNSGSINLHKKLGFEQVGYLPQVGTKFGKWLDLAFLQLMLDGRTEPDRIGG