Protein Info for HSERO_RS22665 in Herbaspirillum seropedicae SmR1

Annotation: transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 PF00072: Response_reg" amino acids 3 to 113 (111 residues), 93 bits, see alignment E=1.4e-30 PF00486: Trans_reg_C" amino acids 146 to 221 (76 residues), 62.6 bits, see alignment E=3e-21

Best Hits

Swiss-Prot: 41% identical to COPR_PSEUB: Transcriptional activator protein CopR (copR) from Pseudomonas syringae pv. tomato

KEGG orthology group: K07774, two-component system, OmpR family, response regulator TctD (inferred from 100% identity to hse:Hsero_4536)

Predicted SEED Role

"Tricarboxylate transport transcriptional regulator TctD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IWW5 at UniProt or InterPro

Protein Sequence (224 amino acids)

>HSERO_RS22665 transcriptional regulator (Herbaspirillum seropedicae SmR1)
MRILLVEDHIELSRWLAKAMRDAHLTVECAHNGADADSLLLTQDYALVILDLTLPRMDGM
EVLKRMRARGNRTPVLILTARGGLADRVSGLNMGADDYLAKPFELEELEARVKALLRRSQ
NNEAVTVSCGALSFDTVSRTFTYGGELLALTPREHAVLEALIVRHGHTVPKEKLFQQVFT
LEDNASMDAIEIYIHRLRKKLEHEGPGRVGITTLRGLGYLLQAT