Protein Info for HSERO_RS22540 in Herbaspirillum seropedicae SmR1

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 transmembrane" amino acids 54 to 78 (25 residues), see Phobius details amino acids 90 to 120 (31 residues), see Phobius details amino acids 167 to 196 (30 residues), see Phobius details amino acids 223 to 247 (25 residues), see Phobius details amino acids 256 to 278 (23 residues), see Phobius details amino acids 288 to 308 (21 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 345 to 364 (20 residues), see Phobius details amino acids 375 to 394 (20 residues), see Phobius details PF07690: MFS_1" amino acids 34 to 324 (291 residues), 100.1 bits, see alignment E=6.2e-33 amino acids 230 to 393 (164 residues), 40 bits, see alignment E=1.2e-14

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_4510)

Predicted SEED Role

"Major facilitator superfamily precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IWT9 at UniProt or InterPro

Protein Sequence (411 amino acids)

>HSERO_RS22540 membrane protein (Herbaspirillum seropedicae SmR1)
MTLQTTAARTPTAETPPAAARKRSLFAACSAHAVHDGLTDVVYVLLPLWQSQFALSYAMV
GMLRGSYSGVMAGCQLLAGRLARRWGRKALLVGGTALAGSAYLLASLAGHVGWLLLALVL
GGLGASTQHPLASSLVAESYEDSGKVKQALSNYNFAGDIGKTLIPGLLGLLLVVASWEVG
TALVGLLGLAAALLLWRLIPADTGQAAAGKKSGPQRSGSGKGLWALLGTGTIDSAVRMGF
LTFLPFLLQGKGAGTAATGVALSLLFVGGAFGKLLCGYLGARIGMMKTVWVTEATTALCI
VLAIWLPLTWLMSLLPLLGLALNGTSSVLYGAVPELAEAGKRDQAFARFYTGTIGAGALA
PILFGRLGDLTSIPSALQILAGLLLLTLPLSWCVQRAIERNAAALGGGPGQ