Protein Info for HSERO_RS22395 in Herbaspirillum seropedicae SmR1

Annotation: RNA polymerase sigma factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 169 transmembrane" amino acids 137 to 151 (15 residues), see Phobius details PF04542: Sigma70_r2" amino acids 17 to 82 (66 residues), 50.1 bits, see alignment E=4.7e-17 TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 17 to 166 (150 residues), 64 bits, see alignment E=6.3e-22 PF07638: Sigma70_ECF" amino acids 77 to 162 (86 residues), 23 bits, see alignment E=1.7e-08 PF08281: Sigma70_r4_2" amino acids 114 to 165 (52 residues), 63.5 bits, see alignment E=2.8e-21 PF04545: Sigma70_r4" amino acids 119 to 164 (46 residues), 38.5 bits, see alignment E=1.7e-13

Best Hits

Swiss-Prot: 48% identical to FECI_ECOLI: Probable RNA polymerase sigma factor FecI (fecI) from Escherichia coli (strain K12)

KEGG orthology group: K03088, RNA polymerase sigma-70 factor, ECF subfamily (inferred from 100% identity to hse:Hsero_4481)

MetaCyc: 48% identical to RNA polymerase sigma factor FecI (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IWR0 at UniProt or InterPro

Protein Sequence (169 amino acids)

>HSERO_RS22395 RNA polymerase sigma factor (Herbaspirillum seropedicae SmR1)
MEILMSPAEAHQEIGGLYREHHGWLVAWLSRRLACRHLGADLAQDTFVRLLGHRPPPDLR
EPRAYLTTIAKGLVASHLRRRQLETAYLEALAALPEPSQPSAEERLLVLDTLCEIDRILD
QLPARARQVFLLAQLDGLPYASIAGLLGISLSTVKRHMVLALRHCLAAL