Protein Info for HSERO_RS22240 in Herbaspirillum seropedicae SmR1

Updated annotation (from data): L-rhamnose isomerase (EC 5.3.1.14)
Rationale: Specifically important for utilizing L-Rhamnose monohydrate. Automated validation from mutant phenotype: the predicted function (5.3.1.14) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: sugar isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 431 TIGR02629: L-rhamnose catabolism isomerase" amino acids 10 to 420 (411 residues), 686.3 bits, see alignment E=7e-211 PF01261: AP_endonuc_2" amino acids 99 to 291 (193 residues), 42.1 bits, see alignment E=4.5e-15

Best Hits

Swiss-Prot: 65% identical to RHAL_RHIME: Probable sugar isomerase R00627 (R00627) from Rhizobium meliloti (strain 1021)

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_4450)

Predicted SEED Role

"L-rhamnose isomerase (EC 5.3.1.14)" in subsystem L-rhamnose utilization (EC 5.3.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IVV8 at UniProt or InterPro

Protein Sequence (431 amino acids)

>HSERO_RS22240 L-rhamnose isomerase (EC 5.3.1.14) (Herbaspirillum seropedicae SmR1)
MSYRIDPQFIAEQNARAHQQLQSDYEALAGVLSRRGCDIEALTGQAQAFAVALPSWGVGT
GGTRFARFPGQGEPRNVFDKIDDCGTIHQLTRVTPGVSLHFPWDRTTDARALREAATQHG
LHFDAVNSNTFQDAAGQAHSYKFGSLTALDPEVRAQAVAHNIDCIELGHALGSKGLTVWI
GDGANFPGQSNLRGALERYLESMRAIYAALPADWLVYIEHKLFEPAFYATTIADWGTSFA
CATELGPKAKCLVDLGHHAPNTNIEMIVARLAQFGKLGGFHFNDSKYGDDDLDSGSINPF
QLFLVFNELRDAAQRDGQAFRPAYMLDQSHNVTDPIESLMTSAVEVQRAYLQAALVDTQA
LSHHQKNNDALMAAQTLKQAFRTDVSAILAMARYRSGGAIDPVALYRASAYRDHKREERP
VVAGRSSSGIV