Protein Info for HSERO_RS22215 in Herbaspirillum seropedicae SmR1

Annotation: branched-chain amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 323 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details transmembrane" amino acids 33 to 49 (17 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 81 to 102 (22 residues), see Phobius details amino acids 109 to 132 (24 residues), see Phobius details amino acids 151 to 170 (20 residues), see Phobius details amino acids 201 to 223 (23 residues), see Phobius details amino acids 229 to 250 (22 residues), see Phobius details amino acids 255 to 274 (20 residues), see Phobius details amino acids 280 to 298 (19 residues), see Phobius details PF02653: BPD_transp_2" amino acids 26 to 294 (269 residues), 128.7 bits, see alignment E=1.2e-41

Best Hits

Swiss-Prot: 36% identical to LSRC_SHIFL: Autoinducer 2 import system permease protein LsrC (lsrC) from Shigella flexneri

KEGG orthology group: K10560, rhamnose transport system permease protein (inferred from 100% identity to hse:Hsero_4445)

MetaCyc: 36% identical to Autoinducer-2 ABC transporter membrane subunit LsrC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-454 [EC: 7.6.2.13]

Predicted SEED Role

"Predicted L-rhamnose ABC transporter, transmembrane component 2" in subsystem L-rhamnose utilization

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.6.2.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IVV3 at UniProt or InterPro

Protein Sequence (323 amino acids)

>HSERO_RS22215 branched-chain amino acid ABC transporter permease (Herbaspirillum seropedicae SmR1)
LLALLTVVLILLVGVRAPVFLSAQSMDNLLTDSAITIMLALAQMLVILTRGIDLSVASNL
ALSGMMSALLAMHFPALPVGVFILMAVLIGLMLGLLNGWLIGYLELPPIVVTLGSMSVYR
GMVFVLSGGAWVSSRNMPADFIAFPLARLGGLTHLVWLGALAVVAIWFLARHTRFGRDLY
AIGNDPAAAAYVGIASRGRLLWTYGLSGAMAGLAGYLWVARYAVAYTEIAYGFELTVIAA
CVIGGVSIAGGVGQVSGAVLGALFLSVINNALPIMRISPFWQSALTGLVILCAVVLNARG
KQGRRKQILPLHGQKSVITGSRA