Protein Info for HSERO_RS21620 in Herbaspirillum seropedicae SmR1

Annotation: amino acid ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 247 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 64 to 92 (29 residues), see Phobius details amino acids 112 to 134 (23 residues), see Phobius details amino acids 146 to 165 (20 residues), see Phobius details amino acids 216 to 237 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 13 to 87 (75 residues), 48.5 bits, see alignment E=4.9e-17 PF00528: BPD_transp_1" amino acids 59 to 241 (183 residues), 64.3 bits, see alignment E=6.6e-22

Best Hits

KEGG orthology group: K02029, polar amino acid transport system permease protein (inferred from 100% identity to hse:Hsero_4326)

Predicted SEED Role

"Amino acid ABC transporter, permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IUR3 at UniProt or InterPro

Protein Sequence (247 amino acids)

>HSERO_RS21620 amino acid ABC transporter permease (Herbaspirillum seropedicae SmR1)
MDFRWSIIQGYAPLFAKGVLMTLQVSLISILIGTVIGLLVGMLRLAEVQHGPWKWPLKSM
RWLAGFYVAFFRGTPLFVQIMLIHFAVMPVLVQQEHGLLITGELARTIKQDYGAFLSGTV
ALSLNAGAYISEIFRAGIQSIERGQSYAAASLGMNYGLTMRYVVLPQAFRRMLPPLGNEA
ITLLKDSSLVSAIGLAELAYAARTVAGTYARYWEPYITISVLYFSMTICLALVVARLESK
YSAPHRR