Protein Info for HSERO_RS21595 in Herbaspirillum seropedicae SmR1

Annotation: type VI secretion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 886 TIGR03361: type VI secretion system Vgr family protein" amino acids 24 to 347 (324 residues), 200.4 bits, see alignment E=4.7e-63 amino acids 379 to 548 (170 residues), 206.8 bits, see alignment E=5.6e-65 TIGR01646: Rhs element Vgr protein" amino acids 36 to 548 (513 residues), 306.5 bits, see alignment E=3.9e-95 PF05954: Phage_GPD" amino acids 42 to 352 (311 residues), 284.7 bits, see alignment E=1.8e-88 PF04717: Phage_base_V" amino acids 436 to 503 (68 residues), 50.7 bits, see alignment 3.7e-17 PF13296: T6SS_Vgr" amino acids 523 to 630 (108 residues), 113.3 bits, see alignment E=1.2e-36 PF10106: DUF2345" amino acids 660 to 807 (148 residues), 166.8 bits, see alignment E=6.1e-53

Best Hits

KEGG orthology group: None (inferred from 100% identity to hse:Hsero_4321)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IUQ8 at UniProt or InterPro

Protein Sequence (886 amino acids)

>HSERO_RS21595 type VI secretion protein (Herbaspirillum seropedicae SmR1)
MPSPSPNDSRRSQARITQHRRLLQLDSSLGPDILLPQRLVATERLNDGYEVTIDLLATHT
GIALEQLIAQPVTLWIRQHDGDTLPLHGYVHTAKRLGSDGELDFCQLSLSPWLHFLRFRK
DARIWQDKRTEDILADVFNNHPQARGHYRFQLERPYTPRPYCTQYETDWHFVQRLMEEEG
WFAHHEQREDGSGHVLVITDNTWNLPGLPQQGIAFHGAAPRDELDKILHWSASRTLSSKG
WRGRSDDYKSPGMKKEAEEQVMPEYGQLPAQLEMYEYTGAYSFRLQEQGNRQADLQVEQW
ESSMQRYSAVSGVRNLACGRWFRLEEHPQHRAEPDRERQFVILAIDWFVENNLPLSHQAL
DFPGSLKGALMAFKESIRRERQVAETDNEHTGHCFNRFEVQRRKLPFRPARAHARPVMLP
QTAIVVGPASEEVYTDHLDRIKVQFRWDRINPGNEAASCWVRVSYPNAGQYWGAIQVPRI
GQEVIVSFLNGDPDRPVVTGRLFNAEQRPQWHTNGRLSGVKSKEFGGTGFNQMVMDDTPE
QNRIHLYSTNTHAQLNLGHLVSQTGNERRSFFGSGFALSTDAYGAIVTHKGLYISTYGRP
GAQGTQLDAREATGQLKSGANLSRTLSETAAKAGAEPLAGQEALRDFIDATQADYEDPSQ
AQANRFQQAILLAASPDGIGLTTPKGVHTHAGGEITLSSGADTSIAVGKSLLASVAEKIS
LFAFKAGIKLFSAKGKVEVQAQSDDLELIAEKVARLLSASGRVEIRAKEEVLITAGGSFI
RLNASGITQGTSGAWEAKAGTHAMPGPTTLAYEMNKSSAALPFDEEFVLRWPYDQSPVKN
RRFEIVRGDGTKVRGVTDAQGKTGLQKSLFVENTSLRILPEGQPPS