Protein Info for HSERO_RS21360 in Herbaspirillum seropedicae SmR1

Annotation: glutamyl-tRNA reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 430 transmembrane" amino acids 256 to 273 (18 residues), see Phobius details TIGR01035: glutamyl-tRNA reductase" amino acids 4 to 426 (423 residues), 408.7 bits, see alignment E=1.5e-126 PF05201: GlutR_N" amino acids 6 to 167 (162 residues), 171 bits, see alignment E=2.3e-54 PF01488: Shikimate_DH" amino acids 183 to 317 (135 residues), 148 bits, see alignment E=2.9e-47 PF00745: GlutR_dimer" amino acids 331 to 427 (97 residues), 87.5 bits, see alignment E=1e-28

Best Hits

Swiss-Prot: 83% identical to HEM1_JANMA: Glutamyl-tRNA reductase (hemA) from Janthinobacterium sp. (strain Marseille)

KEGG orthology group: K02492, glutamyl-tRNA reductase [EC: 1.2.1.70] (inferred from 100% identity to hse:Hsero_4274)

Predicted SEED Role

"Glutamyl-tRNA reductase (EC 1.2.1.70)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See D8IUL1 at UniProt or InterPro

Protein Sequence (430 amino acids)

>HSERO_RS21360 glutamyl-tRNA reductase (Herbaspirillum seropedicae SmR1)
MHLLAVGLNHTTAPVSLREKVAFPADQIGQAVASARAWFGGHDKIVASGEAAILSTCNRT
ELYAAAAAGKDGVEFAIDRTAQFLADYHHIPYADLRPYLYSLPQDNAVRHAFRVASGLDS
MVLGEPQILGQMKDAVRQADAAGGLGTYLHQLFQRTFAVAKEVRSTTEIGAHSVSMAAAA
VRLSQRIFDSISGQNVLFIGAGEMIELCATHFAAQNPKTLTVANRTMERGETLAHRFNGK
AIRLADLPAQLAQFDIVVSCTASSLPIIGLGLVERAVKARRHKPIFMVDLAVPRDIEAEV
GRLDDVFLYTVDDLASVVQTGVENRQAAVAQAEAIIETRVQSFMHWIDSRAMVPLIQDLN
ETGEALRLAELERARRMLAKGEDVEAVLDALSRGLTAKFLHGPQQALHHAQGEQRSQLAA
LLPQLFRAKR