Protein Info for HSERO_RS21350 in Herbaspirillum seropedicae SmR1

Annotation: cell division topological specificity factor MinE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01215: cell division topological specificity factor MinE
  • amino acids 1 to 83 (83 residues), 88.6 bits, E=1.1e-29
• PF03776: MinE
  • amino acids 14 to 82 (69 residues), 72.9 bits, E=8.6e-25

Best Hits

Swiss-Prot: 81% identical to MINE_JANMA: Cell division topological specificity factor (minE) from Janthinobacterium sp. (strain Marseille)

KEGG orthology group: K03608, cell division topological specificity factor (inferred from 100% identity to hse:Hsero_4272)

Predicted SEED Role

"Cell division topological specificity factor MinE" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

See D8IUK9 at UniProt or InterPro

Protein Sequence (89 amino acids)

>HSERO_RS21350 cell division topological specificity factor MinE (Herbaspirillum seropedicae SmR1)
MSLLSFLFPSKPKSAVAAKERLQIIIARERSNGRQGPDFLPALHKELIEVISKYTKVNAD
DIKISLDRQGNLEVLDVNVVLPDSDVPAA